AETA peptide contributes to Alzheimer’s disease signature of synapse dysfunction

Human brain samples

All experiments were performed in accordance with relevant guidelines and regulations. The case–control study of post-mortem human brain was approved by ministère de l’enseignement supérieur, de la recherche et de l’innovation (CODECOH No. DC-2022-5317). Human hippocampi were obtained from The Netherlands Brain Bank (NBB), Netherlands Institute for Neuroscience, Amsterdam, Netherlands (open access: www.brainbank.nl). Human prefrontal cortex samples were obtained from the Neuro-CEB Brain bank, Hôpital de la Pitié-Salpêtrière, Paris, France (open access: www.neuroceb.org). All materials were collected from donors for or from whom a written informed consent for a brain autopsy and the use of the material and clinical information for research purposes had been obtained by the NBB and Neuro-CEB. Patients had ante-mortem evidence of clinical dementia, whereas controls did not. Controls were selected by matching for age and sex (see Supplemental Tables S1 and S2 for details).

Mice

All experiments were performed on 6–10-month-old mice, unless specified in figure legend. Both sexes were used throughout the study and indicated for each experiment in legends and statistical analysis tables. All experiments and protocols on mice were performed in accordance with specific European laws described in the European Communities’ Council Directive 2010/63/EU. Protocols used in this study were approved by the committee for the Care and Use of Laboratory Animal in the framework of project authorizations APAFIS#6856-2016091610462338 and APAFIS#37493-2022050311352580s. Mice had ad libitum access to tap water and standard chow. Mice were maintained under constant environmental conditions (12 h:12 h light/dark cycle, 23 ± 2 °C and humidity of 55%). They were housed in groups of 5 or 6 animals by sex in standard mouse cages (542 cm2) under Specific Pathogen Free (SPF) status. Sex used is reported for each experiment.

Generation and maintenance of AETA-m mouse line

Generation of AETA-m mouse line was briefly described previously [11]. Human AETA (the long alpha form) was first cloned into the multiple cloning site of pSecTag 2A plasmid downstream of the Igk-chain leader sequence for secretion (Invitrogen Life Technologies, France) and then cloned into cDNA inserted in the mouse thy-1 gene cassette at the XhoI site of the pTSC21k plasmid [2, 29]. This expression cassette was then linearized and injected into male pronuclei of fertilized zygotes of C57Bl6/NCrl donor mice. Embryos were transferred into Crl:CD1(ICR) pseudopregnant recipient female mice (ca. 20 embryos per recipient). The recipient mice were mated with sterile males (vasectomized) Crl:CD1(ICR). The AETA-m mouse line was chosen among four founder lines as it displayed moderate expression of recombinant AETA in the hippocampus and cortex (data not shown). Mice were generated under the license 24-9168.11-9/2012-5. All animal experiments were performed in accordance with the European Communities Council Directive (86/609/EEC) and were approved by the local ethics committee (Government of Saxony, Germany). The line was backcrossed regularly (at least 8 generations prior to use of mice for experiments) on C57/BL6J background strain (Charles River, France). Mouse genotype was confirmed by genomic DNA extraction from tissue and PCR as follows: primer sequences: CGCGCCATGATTAGTGAA and GACCTCTGCAGAGGAAGGA; PCR protocol: 5 min 95 °C, 10 cycles of 94 °C-30 s/62 °C-30 s/72 °C-30 s, 24 cycles of 94 °C-30 s/52 °C-30 s/72 °C-30 s, 7 min 72 °C. PCR samples were run on 2% agarose gel containing ethidium bromide and visualized by UV light.

Expression of pSeg-Tag 2A-human AETA cDNA in CHO cells

CHO cells were either untransfected or transiently transfected with the pSeg-Tag 2A-human AETA cDNA with lipofectamine. Conditioned OPTIMEM medium from both plates was harvested after 48 h of expression. The collected media (from control untransfected or transfected CHO cells) were split in half and were directly loaded on two 12% Tris–Glycine gels for immunoblotting with 2E8 or 2E9 as detailed in immunoblotting of APP peptides section below.

Collection of cerebrospinal fluid (CSF) from cisterna magna of mice

Collection of cerebrospinal fluid was performed using a stereotaxic frame (Kopf Instruments) under general anesthesia with xylazine and ketamine (10 mg/kg and 150 mg/kg, respectively). The head was set with a 35° angle down. To expose the cisterna magna, a sagittal incision of the skin, inferior to the skull, was made, and the subcutaneous tissue and neck muscles were separated through the midline. Two warming steps were used to prepare a capillary glass (step 1: 65.1 °C; step 2: 52.7 °C). The large end of the capillary glass was attached to a 1 ml syringe to apply suction. This sharp end of the capillary glass was used to puncture the cisterna magna. The CSF was then transferred into a tube and snap frozen in liquid nitrogen.

Immunoblotting of APP peptides in mouse and human tissues

Mouse and human brain homogenates for analysis of APP processing products (AETA and APP-FL (full-length) for human brain; AETA, APP-FL, sAPPα/β and CTF-η for mouse brains) were essentially prepared as described previously [51]. In brief, DEA lysates (0,2% diethylamine in 50 mM NaCl, pH 10) and RIPA lysates (20 mM Tris–HCl pH 7.4, 150 mM NaCl, 1 mM Na2EDTA, 1% NP-40, 0,5% sodium deoxycholate, 0,05% Triton X-100) with protease inhibitors (Sigma-Aldrich, P8340) were prepared from brain samples using the Precellys system (Bertin) for homogenisation followed by ultracentrifugation. For the DEA and RIPA samples, we used the Bradford (Biorad) to measure protein concentration, which was adjusted equally to all samples before immunoblotting. AETA (human and mouse), sAPPα/β (mouse), and GAPDH (human) were quantified in DEA fraction, and CTF-η (mouse) and full-length APP (human and mouse) were quantified in RIPA fraction. For detection by immunoblotting, proteins were separated on 8% Tris–Glycine gels or alternatively on Tris-Tricine (10–20%, Thermo Fisher Scientific) gels, transferred to nitrocellulose membranes (0.22 μm, GE Healthcare) which were boiled for 5 min in phosphate buffer saline (PBS) and subsequently incubated with the blocking solution containing 0.2% I-Block (Thermo Fisher Scientific) and 0.1% Tween 20 (Merck) in PBS for 1 h, followed by overnight incubation with antibody in the blocking solution. Antibody detection was performed using the corresponding anti-rat/mouse/rabbit-IgG-HRP-conjugated secondary antibody (Thermo Fisher Scientific) and chemiluminescence detection reagent ECL (Thermo Fisher Scientific). Antibodies used for immunoblotting were: anti-GAPDH (#G9545, Sigma-Aldrich, rabbit IgG, 1/1000 dilution), M3.2 (Biolegend, #805701; mouse IgG, 1/5000 dilution) for detection of mouse AETA and CTF-η, 2D8 (Sigma-Aldrich, #MABN2273, rat IgG; 2 μg/ml) or 2E9 (Sigma-Aldrich, #MABN2295, rat IgG, 2 μg/ml) for detection of human AETA, Y188 (Abcam, ab32136; rabbit IgG, 1/1000 dilution) for detection of human and mouse APP-FL, and 22C11 (Merck, #MAB348; mouse IgG, 1/5000 dilution) for detection of mouse sAPPα/β. For the loading control, when necessary, we used an antibody specific to β-actin (Sigma-Aldrich, #A5316, mouse IgG, 1/5000 dilution) or Ponceau staining (as stated in results description, see also Supplemental file with full blots). Ponceau staining was generally chosen for normalization as limitations in housekeeping genes have been previously evidenced when comparing normal and diseased tissues [12]. For quantification, peptide levels were normalized to WT average for each immunoblot. For quantification of recombinant human AETA in hippocampi of AETA-m mice, the standard curve was made using the following synthetic peptide (Peptide Specialty Laboratories; PSL GmbH; Heidelberg, Germany):

MISEPRISYGNDALMPSLTETKTTVELLPVNGEFSLDDLQPWHSFGADSVPANTENEVEPVDARPAADRGLTTRPGSGLTNIKTEEISEVKMDAEFRHDSGYEVHHQK.

The peptide was dissolved in dimethyl sulfoxide (DMSO) at 100 μM and placed at − 80 °C for long-term storage and diluted to final concentration on the day of experiment.

Immunohistochemistry

For cresyl violet staining, brains were quickly removed and maintained in 4% paraformaldehyde (PFA) for 24 h, then washed in PBS. Brain sections (40 µm) were sliced with a vibratome (Leica VT 1000S). Cresyl violet staining to label Nils bodies was performed on slices just after slicing procedure as follows. Slices were mounted on superfrost slides (VWR) and allowed to dry. Dried slices were stained for 3 min in cresyl violet solution (5 g cresyl violet/3 ml acetic acid/1 l ddH2O, filtered), then well rinsed in ddH2O. Slices were further washed in successive baths 70, 90, and 100% ethanol for 1 min each. Slices were dried again at room temperature and mounted in Entellan (Sigma-Aldrich). Pictures were taken under Olympus BX41 microscope at 10 × magnification. Cell body layer thickness was calculated manually with Image J software with the experimenter blinded to mouse genotype.

For 2E9, GFAP and IBA-1 immunohistochemistry on hippocampal slices, mice were submitted to an intracardiac perfusion with saline (0.9% NaCl) to remove blood, and then with PFA (4%) to fix tissues. Brains were removed and maintained in PFA for 24 h, then washed in phosphate buffer saline (PBS). Brain sections (30 µm) were sliced with a vibratome (Leica VT 1000S). For GFAP and IBA-1 staining, slices were incubated in H202 (0.3% in PBS) two times for 10 min to remove endogenous peroxidase. For all staining (GFPA, IBA-1, 2E9), slices were then incubated with tween solution (0.3% in PBS) for 10 min to permeabilize tissues and then incubated with blocking solution normal goat serum (2.5% in PBS) for 2 h at room temperature. Incubation of primary antibodies diluted in blocking solution was performed overnight at 4 °C with the following antibodies 2E9 (specific to human AETA; Sigma-Aldrich, #MABN2295, rat IgG, 2 μg/ml), anti-mouse GFAP (1/400; Sigma-Aldrich, G3893) or anti-rabbit IBA-1 (1/800; Wako 019-19741). Slices were washed three times with PBS. For GFAP and IBA-1 staining, slices were then incubated 1 h with secondary antibody HRP in PBS 1 h at room temperature: anti-mouse (pk-4010, Vector) or anti-rabbit (pk-4001, Vector) and HRP staining was performed with kit DAB sk-4100, Vector as described in manufacturer instructions. Slices were washed again 3 × in PBS, dried and mounted in Entellan (Sigma-Aldrich, 1.07960). Pictures were taken under a DMD108 Leica microscope at magnification 63 × for counting cell number. Quantification of GFAP and IBA-1 positive cells was done using Image J with experimenter blind to genotype during analysis. For 2E9 staining, slices were incubated 1 h with secondary antibody anti-rat Alexa-488 (1/1000; Thermofisher; A21208) in PBS 1 h at room temperature, washed again 3 × in PBS, incubated 10 min with DAPI (1 μg/ml; Roche, 10236276001), dried and mounted in Mowiol (Sigma-Aldrich, 81381). Pictures where taken under epifluorescence Zeiss Axioplan2.

qPCR

RNA was extracted from human hippocampi obtained from the NBB (Supplemental Table S1) using the RNeasy Lipid Tissue kit (Qiagen) according to the manufacturer’s instructions. The samples were retrotranscribed using Promega GoScript Reverse Transcriptase kit according to the manufacturer’s instructions in a Biometra TAdvanced thermal cycler according to the program: 5 min at 25 °C, 50 min at 42 °C and 15 min at 70 °C. The qPCR amplification of genes was performed on a mix consisting of 1 μl of RT product diluted at 900 ng/µl and 19 μl of mix (containing 10 μl of LightCycler 480 SYBR green I master, 7 μl of UltraPure water, 1 μl of forward primer and 1 μl reverse primer). The qPCR was performed with the LightCycler 480 (Roche) (95 °C for 5 min, (95 °C for 10 s, 60 °C for 30 s, 72 °C for 30 s) × 40 cycles). The melting curve was obtained by increasing the temperature by 1 °C every 30 s from 70 to 95 °C. Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) was used as a reference gene. Primers used for this qPCR analysis are described in Supplemental Table S3.

Mouse hippocampi were dissected and snap frozen in liquid nitrogen. The samples were retrotranscribed in a Biometra gradient T-type thermal cycler (Applied Biosystems VeritiPro) according to the program: 10 s at 25 °C, 120 min at 37 °C, 5 s at 85 °C. The qPCR amplification of genes was performed using SYBR green (Applied Biosystems; #4367659). The samples were diluted to 1/10 (for an RT of 500 ng/20 μl). qPCR was performed on a mix consisting of 2 μl of RT product diluted and 8 μl of mix (containing 5 μl of SYBR green, 2.8 μl of RNase-free water, 0.1 μl of forward primer and 0.1 μl reverse primer). The qPCR was performed with the StepOnePlus Real-Time PCR System (Biosystems) (50 °C for 2 min, 95 °C for 10 min, (95 °C for 15 s, 60 °C for 25 s) × 40 cycles, 95 °C for 15 s). The melting curve was obtained by increasing the temperature by 1 °C every minute from 60 to 95 °C. Peptidylprolyl isomerase A (PPIA, also known as Cyclophilin A) was used as a reference gene. Primers used for this qPCR analysis are described in Supplemental Table S3.

RNA sequencing

Mouse hippocampi were rapidly dissected and snap frozen in liquid nitrogen. Messenger RNAs (mRNA) from tissues were prepared following the Illumina® Stranded mRNA Prep protocol. They were then sequenced on an Illumina® NextSeq 2000 sequencer, each library receiving at least a 40 M reads sequence coverage. Generated FASTQ files were used as input of the nf-core/rna-seq nextflow pipeline (v3.8.1), which performed quality control, trimming and alignment to the mouse reference genome GRCm39 with default parameters (alignment with STAR v2.7.10a followed by quantification with Salmon v1.5.2). Raw counts matrix was then loaded and processed in R (v4.3.1) to perform differential expression analysis following the standard DESeq2 framework (v1.40.2). Genes with a log2FC > 0.2 or log2FC < − 0.1, an adjusted P value < 0.05 and a minimal base mean > 10 in either AETA-m or WT were designated as differentially expressed (DESeq2 analysis output provided in Supplemental Tables S4 and S5 for female data and Table S7 for male data). Functional annotation of genes identified as differentially expressed was performed using the Ingenuity Pathway Analysis (IPA) tool (QIAGEN Inc., https://digitalinsights.qiagen.com/IPA). For comparison with the human NBB-HPC-AD cohort, we extracted the RNA-seq data from the supplemental tables provided by Van Rooij et al. [38]. To compare the neuron function-linked signature obtained in the AETA-m mouse model with the other human AD RNA-seq data, we extracted supplemental tables provided by Marques-Coelho et al. [26], which correspond to the differential expression analysis between disease and control RNA-seq samples from MSBB BM36 and MSBB BM22 cohorts [48], and the ROSA cohort [9], performed with DESeq2. For comparison with the NBB-PD cohort [7], we ran the differential expression analysis between Braak Lewis Body stages 5 versus 0 (no pathology) samples with the same workflow used for the analysis of our mouse data, starting from the raw count matrix extracted from GSE216281.

Immunoblotting of p38 and tau in mouse hippocampi

For p38 immunoblotting, freshly dissected mouse hippocampi were homogenized with a potter and then passaged through a 1 ml syringe with needle (26G) in 150 μl Tris buffer (pH 7.5) containing 2% SDS, 1% triton X100, 10% glycerol, protease inhibitors (#P5726, Sigma-Aldrich), and phosphatase inhibitors (#P8340, Sigma-Aldrich). Lysates were centrifuged for 10 min at 9000 rpm. Proteins in the supernatant were quantified by BCA assay (Pierce) and stored at − 80 °C until further use. 10 or 20 μg of samples were loaded on precast Novelx 4–20% Tris-tricin gels, in quadruplicates, and transferred to nitrocellulose membranes (0.22 μm, GE Healthcare) which were subsequently incubated with the blocking solution containing 0.2% I-Block (Thermo Fisher Scientific) and 0.1% Tween 20 (Merck) in PBS for 1 h, followed by overnight incubation with primary antibody in the blocking solution. One set of gels was first immunoblotted for P38, then membranes were stripped, reblocked as above and then immunoblotted for P-P38. Another set of gels was first immunoblotted for P-P38 and then P38. The stripping procedure consisted of incubating membranes in ddH20 containing 1.5 g/l glycine, 0.1% SDS, 1% tween 20 for 15 min at room temperature followed by rinsing two times for 5 min with PBS. Primary antibodies used were rabbit anti-MAPK p38 (#8690, Ozyme; diluted 1/1000) and mouse anti-phospho-p38 (#9216, Ozyme; diluted 1/400). Antibody detection was performed using the corresponding anti-mouse/rabbit-IgG-HRP-conjugated secondary antibody (Thermo Fisher Scientific) and chemiluminescence detection reagent ECL (Thermo Fisher Scientific). Quantification of immunoblots to calculate P-p38/p38 ratio was performed using ImageJ software.

For Tau and phosphorylated tau immunoblotting, previously snap-frozen mouse hippocampi were homogenized in 200 μl Tris buffer (pH 7.4) containing 10% sucrose and protease inhibitors (Complete; Roche Diagnostics) and sonicated. Homogenates were kept at − 80 °C until use. Protein concentrations of the samples were quantified using the BCA assay (Pierce), diluted in lithium dodecyl sulfate buffer supplemented with reducing agents (Invitrogen) and then separated on 4–12% Criterion Bis–Tris Gels (Invitrogen). Proteins were transferred to nitrocellulose membranes, which were then saturated with 5% non-fat dried milk in TNT (Tris 15 mM pH 8, NaCl 140 mM, 0.05% Tween) and incubated at 4 °C for 24 h or 48 h with the primary antibodies. Rabbit polyclonal anti-C ter (home-made, D. Blum, 24 h incubation) was diluted at 1/4000. Mouse monoclonal anti-Tau1 (Millipore # #MAB3420, 24 h incubation) was diluted at 1/10000. Rabbit polyclonal anti-phospho-Tau (Ser199) (home-made, 24 h incubation) was diluted at 1/2000. Rabbit polyclonal anti-phospho-tau (Ser396) (Invitrogen #44-752G, 48 h incubation) was diluted at 1/10000. Appropriate HRP-conjugated secondary antibodies were incubated for 45 min at RT. Signals were visualized using chemiluminescence kits ECL (#RPN2106; Amersham) or ECL Prime (#RPN2232; Amersham) and an Amersham ImageQuant 800 imaging system. Quantifications were performed using ImageJ software, and results were normalized to β-actin for C-ter and Tau-1 levels, and normalized to β-actin and to C-ter Tau levels for phosphorylated Tau pS199 and pS396.

Electrophysiology in hippocampal slices

For ex vivo electrophysiology recordings, 6–10-month-old males and females AETA-m and WT littermates were used. Mice were culled by cervical dislocation. Hippocampi were dissected and sliced (250 μm for patch-clamp recordings, 350 μm for field recordings) on a vibratome (Microm HM600V, Thermo Scientific, France).

Different external solutions for slicing, recovery, and recording were used in this study as follows. For most LTP recordings (except experiment in Figure S5d), after dissection, hippocampi were incubated for 5 min and then sliced in ice-cold oxygenated (95% O2/ 5% CO2) cutting solution (in mM): 234 sucrose, 2.5 KCl, 1.25 NaH2PO4, 10 MgSO4, 0.5 CaCl2, 26 NaHCO3, 11 glucose (pH 7.4). For recovery (1 h at 37 °C) and recordings (at 27–29 °C), slices were then incubated in artificial cerebral spinal fluid (aCSF; in mM): 119 NaCl, 2.5 KCl, 1.25 NaH2PO4, 26 NaHCO3, 1.3 MgSO4, 2.5 CaCl2 and 11 D-glucose, oxygenated with 95% O2 and 5% CO2, pH 7.4 for 1 h at 37 ± 1 °C. For field LTD recordings, after dissection, hippocampi were incubated for 5 min, sliced in ice-cold oxygenated (95% O2/5% CO2) and then incubated for recovery (1 h at 37 °C) in the same condition as described above for LTP. To optimize LTD recordings, slices were recorded (at 27–29 °C) in another aCSF (in mM): 119 NaCl, 2.5 KCl, 1.25 NaH2PO4, 26 NaHCO3, 2 MgSO4, 4 CaCl2 and 11 D-glucose, oxygenated with 95% O2 and 5% CO2, pH 7.4 for 1 h at 37 ± 1 °C, with picrotoxin (50 μM; Sigma-Aldrich, France) supplementation to block GABAA receptors. For experiment in Fig. S5d, after dissection, hippocampi were incubated for 5 min and then sliced in ice-cold oxygenated (95% O2/ 5% CO2) cutting solution (in mM): 206 sucrose, 2.8 KCl, 1.25 NaH2PO4, 2 MgSO4, 1 CaCl2, 26 NaHCO3, 0.4 sodium ascorbate, 10 glucose (pH 7.4). For recovery (1 h at 37 °C) and recordings (at 27–29 °C), slices were then incubated in aCSF (in mM): 124 NaCl, 2.8 KCl, 1.25 NaH2PO4, 26 NaHCO3, 2 MgSO4, 3,6 CaCl2, 0.4 sodium ascorbate and 10 d-glucose, oxygenated with 95% O2 and 5% CO2, pH 7.4 for 1 h at 37 ± 1 °C.

For all whole-cell patch-clamp recordings, slicing, recovery, and recordings were made in same aCSF as for most LTP experiments described above. Recordings were performed at 30–31 °C. The recording aCSF was supplemented with picrotoxin (50 μM; Sigma-Aldrich, France). For NMDAR spontaneous excitatory postsynaptic current (sEPSC) recordings, the aCSF was also supplemented with NBQX (10 μM; Tocris, England) to block AMPAR activity. For AMPAR sEPSC recordings, the aCSF was also supplemented with APV (50 μM; Tocris, England) to block NMDAR activity.

All recordings were made in a recording chamber on an upright microscope with IR-DIC illumination (SliceScope, Scientifica Ltd, UK) using a Multiclamp 700B amplifier (Molecular Devices, San Jose, CA, USA), under the control of pClamp10 software (Molecular Devices, San Jose, CA, USA). Data analysis was executed using Clampfit 10 software. Field excitatory postsynaptic potentials (fEPSPs) were recorded in the stratum radiatum of the CA1 region (using a glass electrode filled with 1 M NaCl and 10 mM 4-(2-hydroxyethyl)-1-piperazineethanesulfonic acid (HEPES), pH 7.4) and the stimuli were delivered at 0.1 Hz to the Schaffer collateral pathway by a monopolar glass electrode filled with aCSF. fEPSP response was set to approximately 30% of the maximal fEPSP response, i.e., approx. 0.2–0.3 mV, with stimulation intensity 10 μA ± 5 μA delivered via a stimulation box (ISO-Flex, A.M.P.I. Inc., Israel). A stable baseline of 20 min was first obtained before induction for long-term plasticity recordings. The time courses were obtained by normalizing each experiment to the average value of all points constituting a 20 min stable baseline before induction. fEPSP magnitude was measured during the last 15 min of recording (45–60 min after induction) and calculated as % change fEPSP slope from baseline average.

For patch-clamp recordings, after obtaining a tight seal (> 1 GΩ) on the cell body of the selected neuron, whole-cell patch-clamp configuration was established, and cells were left to stabilize for 2–3 min before recordings began. Holding current and series resistance were continuously monitored throughout the experiment, and if either of these two parameters varied by more than 20%, the cell was discarded.

For paired-pulse ratios (PPR), EPSCs were obtained and two stimuli were delivered at 100, 200, 300 and 400 ms inter-stimulus interval (ISI). PPR was calculated as EPSC2 slope/EPSC1 slope (10 sweeps average per ISI). Recordings of WT and AETA-m mice were interleaved between days. Internal solution was a CS-gluconate solution: 117.5 mM Cs-gluconate, 15.5 mM CsCl, 10 mM TEACl, 8 mM NaCl, 10 HEPES, 0.25 mM EGTA, 4 mM MgATP, and 0.3 NaGTP (pH 7.3; osmolarity 290–300 mOsm).

AMPAR sEPSCs were recorded at − 65 mV using the same CS-gluconate internal solution detailed above. NMDAR sEPSCs were recorded at − 65 mV using a Cesium-methanesulfonate internal solution (mM): 143 Cesium-methanesulfonate, 5 NaCl, 1 MgCl2, 1 EGTA, 0.3 CaCl2, 10 Hepes, 2 Na2ATP, 0.3 NaGTP and 0.2 cAMP (pH 7.3 and 290–295 mOsm). sEPSCs were recorded in gap-free mode for 5 min for individual neurons of each genotype (WT and AETA-m). The Clampfit 10.6 software (Axon instruments) was used for analysis of sEPSCs to compare frequencies and amplitudes. sEPSCs were detected manually by following criteria of peaks with a threshold 2xSD of baseline noise level and a faster rise time than decay time. Analyses were performed blind to experimental condition. In the NMDAR sEPSC condition, we had previously ensured that the recorded currents were NMDAR current as they were absent in presence of APV [11].

Golgi-Cox staining for spine density analysis

Brains were rapidly collected and impregnated in a Golgi-Cox solution (1% potassium dichromate, 1% mercuric chloride, 0.8% potassium chromate) for 3 weeks at room temperature according to manufacturer instruction (FD rapid GolgiStain kit, FD Neurotechnologies, USA). Brains were sectioned coronally (80 µm) using a vibratome, and stained and mounted according to protocol. Images were acquired under white light on a DMD108 Leica microscope (60X magnification). Spine density (number of spines per 1 µm length) in selected segments (minimum of 30 per mouse) of secondary dendrites of CA1 pyramidal neurons in stratum radiatum was estimated using Image J and manual count by an experimenter blinded to mouse genotype. As several batches of female mice were processed at independent times (always pairing WT with AETA-m mice), the values per batch were normalized to the average WT spine density value before pooling the data for final statistical analysis per mouse. As only one batch of male mice was processed, we did not require this additional normalization and data are thus presented as spine number/μm.

Morris water maze

AETA-m (6–10 months old) were submitted to the Morris water maze task in either a 90 cm or a 150 cm pool. The apparatus consisted in a circular tank (Ø 90 cm or 150 cm) filled with water (temperature 25 ± 1 °C) made opaque with the addition of white opacifier (Viewpoint, France). For the 90 cm pool protocol, the test consisted of three phases: (1) cue task training (2 days), (2) spatial learning training (7 days), and (3) long-term reference memory Probe test (at 24 h and at 7 days). An escape platform (Ø 8 cm) was submerged 1 cm below the water surface for the cue task training and the spatial learning training. The animals performed four trials/day with a maximum trial duration of 90 s (+ 30 s on the platform at the end of each trial) and with an inter-trial interval of 10 min. During the cue task, a visible flag was placed on the top of the submerged platform and the tank was surrounded by opaque curtains. The mice were allowed to find the visible platform. The platform emplacement was changed for the second day of the cue task (day 2). For the spatial learning training phase, extra-maze cues were placed on the walls surrounding the maze to allow the animals to create a spatial map and find the submerged platform. A new platform placement was designed and kept in the same position for the 7 training days. Probe test was run to assess the strength of the memory for the platform location: the platform was removed, and the test mouse was allowed to search for it for 90 s. For the 150-cm-pool protocol, the test consisted of three phases: (1) cue task training (1 day), (2) spatial learning training (8 days) and (3) long reference memory probe test [at 24 h and at 7 days (for males only)]. Similarly, an escape platform (Ø 8 cm) was submerged 1 cm below the water surface for the cue task training and the spatial learning training. During cue task training, a visible flag was placed on top of the submerged platform and the tank was surrounded by opaque curtains. Mice were allowed to find the visible platform. The mice performed the test along two sessions (T1 and T2) of three trials each with a maximum trial duration of 90 s (+ 30 s on the platform at the end of each trial) and with an inter-trial interval of 10 min. For the spatial learning training phase, extra-maze cues were placed on the walls surrounding the maze to allow the animals to create a spatial map to find the submerged platform and the tank was surrounded by white and patterned curtains. A new platform placement was designed and kept in the same position for 8 training days until the WT group reached the performance criteria. The probe test was run at 24 h and 7 days (for males only) to assess memory strength at which time the platform was removed, and the test mouse was allowed to search for it for 60 s. For both protocols, the training phase was stopped once the WT mice exhibited an average latency that was statistically different from the first day of training and not statistically different from 20 s. All the trials were video recorded and tracked using ANYmaze software (Stoelting, Wood Dale, USA) to analyze escape latency.

Statistical analysis

Results are shown as mean ± S.E.M. Numbers and their correspondence are given in each figure. Statistical analysis was performed with GraphPad Prism 9 software (Dotmatics). Statistical analyses are described in brief in figure legends and are presented in detail in Supplemental Tables S8–S16 (one table per figure). Statistical significance was set at p < 0.05; *p < 0.05; **p < 0.01; ***p < 0.001; ****p < 0.0001.

Use of AI and AI-assisted technologies

ChatGPT (OpenAI, USA) was used in order to improve readability and language. After using this tool, the lead author reviewed and edited the content as needed and takes full responsibility for the content of the publication.

Availability of data and materials

All RNA sequencing data generated in this study have been deposited in the Gene Expression Omnibus (GEO) under series accession number GSE333329 (https://www.ncbi.nlm.nih.gov/geo/query/acc.cgi?acc=GSE333329).

Comments (0)

No login
gif